PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G1601
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 226aa    MW: 26067.6 Da    PI: 9.4098
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G1601genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEde+l+ +++ +G g+W++ ++  g+ R++k+c++rw +yl
      Gh_A11G1601 14 KGSWTREEDERLIAYIQAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     799*****************************99************97 PP

2Myb_DNA-binding57.23.9e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T eEdel+++ + +lG++ W+ Ia +++ gRt++++k++w+++
      Gh_A11G1601  67 RGNFTDEEDELIIKFHSLLGNK-WSIIAGRLP-GRTDNEIKNHWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.554961IPR017930Myb domain
SMARTSM007178.1E-131363IPR001005SANT/Myb domain
SuperFamilySSF466891.95E-2913108IPR009057Homeodomain-like
PfamPF002495.5E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-231568IPR009057Homeodomain-like
CDDcd001678.13E-101661No hitNo description
PROSITE profilePS5129428.77562116IPR017930Myb domain
SMARTSM007179.5E-1766114IPR001005SANT/Myb domain
PfamPF002496.3E-1667111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-2769116IPR009057Homeodomain-like
CDDcd001672.75E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MGRSPCCEKG HTYKGSWTRE EDERLIAYIQ AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDVKRGNF TDEEDELIIK FHSLLGNKWS IIAGRLPGRT DNEIKNHWNT HIKRKLLSRG  120
IDPLTHRPVN EQAAIHTIDT VSSTAVLRED ERQTNQELNL ELQISPPSLH SHPPQVLRKR  180
NRKVICFYCS LGLRNSKECT CEGSSHSRSI QHVSFCTWRK AFQSEN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-301411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.206900.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591677e-71AJ459167.1 Gossypium hirsutum partial myb137 gene, clone pGhMYB137.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491518.11e-162PREDICTED: myb-related protein 308-like
SwissprotP813931e-96MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A0B0N7Y91e-169A0A0B0N7Y9_G
STRINGPOPTR_0005s11410.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-90myb domain protein 4